Recombinant Human SFTPA1 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens surfactant protein A1 (SFTPA1), transcript variant 6 (NM_001164646).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8IWL2
Entry Name SFTA1_HUMAN
Gene Names SFTPA1 COLEC4 PSAP SFTP1 SFTPA SFTPA1B
Alternative Gene Names COLEC4 PSAP SFTP1 SFTPA SFTPA1B
Alternative Protein Names Pulmonary surfactant-associated protein A1 (PSP-A) (PSPA) (SP-A) (SP-A1) (35 kDa pulmonary surfactant-associated protein) (Alveolar proteinosis protein) (Collectin-4)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 248
Molecular Weight(Da) 26242
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Background
Function FUNCTION: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages (By similarity). {ECO:0000250|UniProtKB:P35242}.; FUNCTION: (Microbial infection) Recognition of M.tuberculosis by dendritic cells may occur partially via this molecule (PubMed:17158455, PubMed:21203928). Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages (PubMed:21123169). {ECO:0000269|PubMed:17158455, ECO:0000269|PubMed:21123169, ECO:0000269|PubMed:21203928}.
Pathway
Protein Families SFTPA family
Tissue Specificity
QC Data
Please contact us for specific QC data.
$389.00
In stock
SKU
EB-EPE8509231

Recombinant Human SFTPA1 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human SFTPA1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.